PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN542665.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 947aa    MW: 105055 Da    PI: 7.0796
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN542665.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS269.79.3e-83204392374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilk 92 
                        v lL ecA +v++g++e+a+   ++++ l   ++ p+qRl + ++  La+rl++s ++l  al  ps+    + s+  aa++ f+++ P+l 
  KN542665.1_FGP001  20 VPLLHECASHVTEGSFEKADFSFKKIRMLT-IADGPLQRLSTIIVDSLAHRLLSSIQGLPGALiDPSDYF--EKSTLRAARHNFFKLNPYLS 108
                        6789**********************9876.5667*******************9999998874444443..35555567778********* PP

               GRAS  93 fshltaNqaIleavege....ervHiiDfdis..qGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                         +++t N+aI+ea+e e    + vHi+D++ s  ++ QW+ Ll+ +  Rp+g+p+l +T++++    +++ l  +++ L+k Ae+lgv+f+f
  KN542665.1_FGP001 109 TGFVTINRAIMEAMEDEkvdlQVVHIVDLSCSaaHPWQWLKLLDDFHGRPGGAPELYLTVLHD----DNDFLADMQSLLSKKAESLGVSFHF 196
                        *****************999999******8653389***************************....9************************ PP

               GRAS 179 nvlvakrledleleeLrvkp....gEalaVnlvlqlhrll.........................................desvsleserd 225
                           v  rle+l++++Lr       g a+a++++lq+hrll                                           s  +++   
  KN542665.1_FGP001 197 IS-VIGRLETLDFSNLRSTFqikfGVAVAISCALQMHRLLlvddnlsstsiaqlqkmanftqpkqmassvcspastlnylqTPSPRTPKLLA 287
                        **.799**********54444555*******************************************************9866677777889 PP

               GRAS 226 evLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlek 314
                        ++L++++ l+P+++ ++eq+adh++  F +rf e l+yy+alfd+++a ++++    +er  vEr++l++ei+n++ ceg +r erhe+l +
  KN542665.1_FGP001 288 RLLSAIRALKPNIMLIMEQDADHSTLLFRDRFNEVLNYYAALFDCFHAVAAANPgrtDERLRVERMILREEIKNILVCEGVHRHERHERLDQ 379
                        9*********************************************77654444456*********************************** PP

               GRAS 315 WrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        W + +ee+GF++v+ls +a  + k  l  ++ +  + +e++g+l+l+W + +L+s+SaWr
  KN542665.1_FGP001 380 WAMHMEESGFHNVQLSFSAIREGKENLLSFGLKNCQNKEDRGCLLLCWGSTNLYSISAWR 439
                        *******************************888*************************8 PP

2GRAS355.21e-1084999362374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        + lL++cA  vs+g++ +a+ +L+++ +las d+  ++qRlaa+f+ ALa++l++  ++l++al +s++s +    +  a++  ++v P+lk
  KN542665.1_FGP001 499 IGLLYQCAAEVSAGSFDRANLCLEHITQLASLDApHALQRLAAVFADALARKLLNLIPGLSRALLSSANSADA-HLVPVARRHMFDVLPFLK 589
                        679*******************************9*****************************888887544.44446778899******* PP

               GRAS  93 fshltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                        +++lt+N+aIlea+ege+ vH++Df+  + +++QW+aL++a+  R+egpp+lRiT+v++    ske l +++  L+k Ae++++ f+fn+ v
  KN542665.1_FGP001 590 LAYLTTNHAILEAMEGERFVHVVDFSgpAANPVQWIALFHAFRGRREGPPHLRITAVHD----SKEFLANMAAVLSKEAEAFDIAFQFNA-V 676
                        *************************966899****************************....9**************************.7 PP

               GRAS 183 akrledleleeL....rvkpgEalaVnlvlqlhrll........................................................ 214
                        + +l+++++++L     +++gEalaV++vlqlhrll                                                        
  KN542665.1_FGP001 677 EAKLDEMDFDALrhdlGIRSGEALAVSVVLQLHRLLavddgrrhaaagcltpvqiiarssprsfgellerelntrlqlspdasvvsslsphs 768
                        999****9998833335566************************************************************************ PP

               GRAS 215 ......desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                              +++++++ +  ++L++v+slsPk++v++eqea+hn++ F erf eal+yy++lfd+l+ + ++++ er+ vEr+llg+ei+ vvac
  KN542665.1_FGP001 769 paaataAHPTTSTPKLGSFLSAVRSLSPKIMVMTEQEANHNGGAFQERFDEALNYYASLFDCLQRS-AAAAAERARVERVLLGEEIRGVVAC 859
                        ****98555555556999*********************************************999.68889******************** PP

               GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.yrveee..sgslvlgWkdrpLvsvSaWr 374
                        egaer+erhe++++W +r+e+aG++ v ls++ a++a+ ll+ +++ g y+v ++   + ++++W++rpL++v+aWr
  KN542665.1_FGP001 860 EGAERVERHERARQWAARMEAAGMERVGLSYSGAMEARKLLQSCGWAGpYEVRHDpaGHGFFFCWHKRPLYAVTAWR 936
                        *********************************************8888***9776577788**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.6191419IPR005202Transcription factor GRAS
PfamPF035143.2E-8020439IPR005202Transcription factor GRAS
PROSITE profilePS5098550.675472913IPR005202Transcription factor GRAS
PfamPF035143.5E-106499936IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 947 aa     Download sequence    Send to blast
MMHGLWVQDQ GMVDHLAQLV PLLHECASHV TEGSFEKADF SFKKIRMLTI ADGPLQRLST  60
IIVDSLAHRL LSSIQGLPGA LIDPSDYFEK STLRAARHNF FKLNPYLSTG FVTINRAIME  120
AMEDEKVDLQ VVHIVDLSCS AAHPWQWLKL LDDFHGRPGG APELYLTVLH DDNDFLADMQ  180
SLLSKKAESL GVSFHFISVI GRLETLDFSN LRSTFQIKFG VAVAISCALQ MHRLLLVDDN  240
LSSTSIAQLQ KMANFTQPKQ MASSVCSPAS TLNYLQTPSP RTPKLLARLL SAIRALKPNI  300
MLIMEQDADH STLLFRDRFN EVLNYYAALF DCFHAVAAAN PGRTDERLRV ERMILREEIK  360
NILVCEGVHR HERHERLDQW AMHMEESGFH NVQLSFSAIR EGKENLLSFG LKNCQNKEDR  420
GCLLLCWGST NLYSISAWRQ NRGSSSGSRE HMGMFQDDML SSATSSPASS VYSPSPSPSP  480
SNGSWVQELS HDQQSVRLIG LLYQCAAEVS AGSFDRANLC LEHITQLASL DAPHALQRLA  540
AVFADALARK LLNLIPGLSR ALLSSANSAD AHLVPVARRH MFDVLPFLKL AYLTTNHAIL  600
EAMEGERFVH VVDFSGPAAN PVQWIALFHA FRGRREGPPH LRITAVHDSK EFLANMAAVL  660
SKEAEAFDIA FQFNAVEAKL DEMDFDALRH DLGIRSGEAL AVSVVLQLHR LLAVDDGRRH  720
AAAGCLTPVQ IIARSSPRSF GELLERELNT RLQLSPDASV VSSLSPHSPA AATAAHPTTS  780
TPKLGSFLSA VRSLSPKIMV MTEQEANHNG GAFQERFDEA LNYYASLFDC LQRSAAAAAE  840
RARVERVLLG EEIRGVVACE GAERVERHER ARQWAARMEA AGMERVGLSY SGAMEARKLL  900
QSCGWAGPYE VRHDPAGHGF FFCWHKRPLY AVTAWRPAAS RRGHTRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3052893632375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235270.0AC123527.3 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0068G15, complete sequence.
GenBankAC1514800.0AC151480.1 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNAa0068G15, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441716.10.0hypothetical protein SORBIDRAFT_08g001190
TrEMBLI1R3V90.0I1R3V9_ORYGL; Uncharacterized protein
STRINGORGLA12G0021500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-98scarecrow-like 3